PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008155
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 435aa    MW: 48138.7 Da    PI: 5.6223
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58693159PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071.1e-33231285155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr+rWtpeLHe+Fveav++LGGse+AtPk +l+ mkv+gLt++hvkSHLQkYR+
  Lsa008155 231 KPRMRWTPELHEAFVEAVNKLGGSERATPKGVLKQMKVEGLTIYHVKSHLQKYRT 285
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-31228287IPR009057Homeodomain-like
PROSITE profilePS5129413.545228288IPR017930Myb domain
SuperFamilySSF466891.29E-17229285IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-25231285IPR006447Myb domain, plants
PfamPF002492.5E-10233284IPR001005SANT/Myb domain
PfamPF143791.4E-24318363IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
METQHALSIQ RSSPTQLSNH GTTRALSSSF PVHHTTLEEK HPKLLDSQLS STNGTVGHIF  60
SSSSGMSSDL HFSSISPNET CSKKAPFITQ SSGVLRSTAF RQYMKENNTS SWSTDSLSDF  120
LEYPESSPIE PTNLQPTPTE NGSCDLPPED FAKPNDWQDW ADQLITEDDA ATPNWNDILV  180
DTEPKLELPV GGSSTKSMEV KKMVPASPGE LCSPMTPSSC GGGSHSQSQN KPRMRWTPEL  240
HEAFVEAVNK LGGSERATPK GVLKQMKVEG LTIYHVKSHL QKYRTARYKP EPSSEGPSEK  300
KPTSMQDLPS LDLKASLEMT EALRLQVEVQ KRLHEQLEIQ RNLQMRIEEQ GKYLQMIFEK  360
QCKFGIDNLK SSSSTHTPEK SETELLTNEI SSSPVLTEPE TERDPVKVGS PSSKVEVDPL  420
ESQPAKRAKL NDSSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199811.11e-141hypothetical protein PRUPE_ppa004886mg
TrEMBLA0A103XP190.0A0A103XP19_CYNCS; Homeodomain-like protein
STRINGVIT_07s0005g04120.t011e-138(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-88phosphate starvation response 1